Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ki67/MKI67 Protein, Human (GST)

Ki67/MKI67 is localized on mitotic chromosomes and maintains its dispersion during nuclear envelope disassembly. It covers a large portion of the chromosome surface and prevents chromatin from collapsing into clumps. Ki67/MKI67 Protein, Human (GST) is the recombinant human-derived Ki67/MKI67 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

Ki67/MKI67 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ki67-mki67-protein-human-gst.html

Purity

95.0

Smiles

MWPTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQNGRKSTEFPRKIREQEP

Molecular Formula

4288 (Gene_ID) P46013-1 (M1-P120) (Accession)

Molecular Weight

Approximately 36.91 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS1 discontinued
530142-01 20 µL

ADAMTS1 discontinued

Sign In for Pricing
View Details
ADAMTS1 discontinued
530142-02 100 µL

ADAMTS1 discontinued

Sign In for Pricing
View Details
Recombinant Human LHB Protein, N-His
YHB92801 100 μg

Recombinant Human LHB Protein, N-His

Sign In for Pricing
View Details
CENPK CRISPRa sgRNA lentivector (set of three targets)(Rat)
15879126 3x 1.0µg DNA

CENPK CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
TNF Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV689093 1.0 µg DNA

TNF Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RNASE11 Mouse Monoclonal Antibody [Clone ID: LBI2H4]
AMM19712V 100 µL

RNASE11 Mouse Monoclonal Antibody [Clone ID: LBI2H4]

Sign In for Pricing
View Details