Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Fibroblast growth factor 2 (FGF2)

Product Specifications

Product Name Alternative

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

Abbreviation

Recombinant Sheep FGF2 protein

Gene Name

FGF2

UniProt

P20003

Expression Region

10-155aa

Organism

Ovis aries (Sheep)

Target Sequence

PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAN Immunizing Peptide
MBS428424-01 0.1 mg

RAN Immunizing Peptide

Sign In for Pricing
View Details
RAN Immunizing Peptide
MBS428424-02 5x 0.1 mg

RAN Immunizing Peptide

Sign In for Pricing
View Details
Rabbit anti-NOLC1 Antibody
YLD5589-01 50 µL

Rabbit anti-NOLC1 Antibody

Sign In for Pricing
View Details
Rabbit anti-NOLC1 Antibody
YLD5589-02 100 µL

Rabbit anti-NOLC1 Antibody

Sign In for Pricing
View Details
4- (p-Tolyl) -1,10-phenanthroline-2,9-dicarboxylic acid
sc-299323A 250 mg

4- (p-Tolyl) -1,10-phenanthroline-2,9-dicarboxylic acid

Sign In for Pricing
View Details
SNAP 23 Polyclonal Antibody
E20-75231 100 µg

SNAP 23 Polyclonal Antibody

Sign In for Pricing
View Details