Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Rat (HEK293, Fc)

CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-rat-hek293-fc.html

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE

Molecular Formula

307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)

Molecular Weight

Approximately 106-116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ATXN2 (Ataxin 2) ELISA Kit
MBS2511847-01 24 Tests (Limit 1)

Rat ATXN2 (Ataxin 2) ELISA Kit

Sign In for Pricing
View Details
Rat ATXN2 (Ataxin 2) ELISA Kit
MBS2511847-02 48 Tests

Rat ATXN2 (Ataxin 2) ELISA Kit

Sign In for Pricing
View Details
Rat ATXN2 (Ataxin 2) ELISA Kit
MBS2511847-03 96 Tests

Rat ATXN2 (Ataxin 2) ELISA Kit

Sign In for Pricing
View Details
Rat ATXN2 (Ataxin 2) ELISA Kit
MBS2511847-04 5x 96 Tests

Rat ATXN2 (Ataxin 2) ELISA Kit

Sign In for Pricing
View Details
Rat ATXN2 (Ataxin 2) ELISA Kit
MBS2511847-05 10x 96 Tests

Rat ATXN2 (Ataxin 2) ELISA Kit

Sign In for Pricing
View Details
CD31 (PECAM1) Human siRNA Oligo Duplex (Locus ID 5175)
SR303439 1 Kit

CD31 (PECAM1) Human siRNA Oligo Duplex (Locus ID 5175)

Sign In for Pricing
View Details