Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Rat (HEK293, Fc)

CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-rat-hek293-fc.html

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE

Molecular Formula

307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)

Molecular Weight

Approximately 106-116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2175503 1.0 µg DNA

SLC25A1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
pExpress-1-Cxadr Plasmid
PVT38050 2 µg

pExpress-1-Cxadr Plasmid

Sign In for Pricing
View Details
Rat Taf7 Pre-designed siRNA Set B
SI214153B 1 Each

Rat Taf7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Human IgG1/IGHG1 Polyclonal Antibody
PHJ92801 100 μg

Anti-Human IgG1/IGHG1 Polyclonal Antibody

Sign In for Pricing
View Details
Fap Rat shRNA Plasmid (Locus ID 192203)
TR712911 1 Kit

Fap Rat shRNA Plasmid (Locus ID 192203)

Sign In for Pricing
View Details
Lentiviral human TBP shRNA (UAS) - Lentiviral human TBP shRNA (UAS) plasmid
GTR15337222 1 Vial

Lentiviral human TBP shRNA (UAS) - Lentiviral human TBP shRNA (UAS) plasmid

Sign In for Pricing
View Details