Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Rat (HEK293, Fc)

CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-rat-hek293-fc.html

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE

Molecular Formula

307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)

Molecular Weight

Approximately 106-116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r42 sgRNA CRISPR Lentivector set (Mouse)
K3810401 3x 1.0 µg

Vmn1r42 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
DAXX (Death Domain-associated Protein 6, Daxx, hDaxx, Fas Death Domain-associated Protein, ETS1 associated Protein 1, EAP1, BING2, DAP6) (MaxLight 650)
125640-ML650 100 µL

DAXX (Death Domain-associated Protein 6, Daxx, hDaxx, Fas Death Domain-associated Protein, ETS1 associated Protein 1, EAP1, BING2, DAP6) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Mouse NEURL4 Protein, His (Fc)-Avi-tagged
NEURL4-6022M 50 µg

Recombinant Mouse NEURL4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Polr2m (NM_001164793) Mouse Tagged Lenti ORF Clone
MR205631L3 10 µg

Polr2m (NM_001164793) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
OR7E154P 3'UTR Luciferase Stable Cell Line
TU016831 1.0 mL

OR7E154P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
1-Azakenpaullone (9-Bromo-7,12-dihydropyridoazepinoindol-6(5H)-one)
MBS6050392-01 1 mg

1-Azakenpaullone (9-Bromo-7,12-dihydropyridoazepinoindol-6(5H)-one)

Sign In for Pricing
View Details