Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Rat (HEK293, Fc)

CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-rat-hek293-fc.html

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE

Molecular Formula

307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)

Molecular Weight

Approximately 106-116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bismuth (Metal) Powder 99.9% AR
00425 00100 100 g

Bismuth (Metal) Powder 99.9% AR

Sign In for Pricing
View Details
Flt-3 Ligand Recombinant Protein His Tag Lyophilized
MBS8431001-01 0.1 mg

Flt-3 Ligand Recombinant Protein His Tag Lyophilized

Sign In for Pricing
View Details
Flt-3 Ligand Recombinant Protein His Tag Lyophilized
MBS8431001-02 5x 0.1 mg

Flt-3 Ligand Recombinant Protein His Tag Lyophilized

Sign In for Pricing
View Details
Lentiviral human TYK2 shRNA (UAS) - Lentiviral human TYK2 shRNA (UAS, iRFP) (25)
GTR15331181 1 Vial

Lentiviral human TYK2 shRNA (UAS) - Lentiviral human TYK2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ACOD1 Protein, Mouse, Recombinant (His)
MF-0061755-01 5 µg

ACOD1 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
ACOD1 Protein, Mouse, Recombinant (His)
MF-0061755-02 10 µg

ACOD1 Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details