Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Rat (HEK293, Fc)

CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-rat-hek293-fc.html

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE

Molecular Formula

307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)

Molecular Weight

Approximately 106-116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cartilage Associated Protein (CRTAP) BioAssayTM ELISA Kit (Mouse)
023951 96 Tests

Cartilage Associated Protein (CRTAP) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
Sel1l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6698005 3x 1.0 µg

Sel1l sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Human beta Catenin (CTNNB1) activation kit by CRISPRa
GA101060 1 Kit

Human beta Catenin (CTNNB1) activation kit by CRISPRa

Sign In for Pricing
View Details
TAB2 (NM_001292034) Human Untagged Clone
SC337216 10 µg

TAB2 (NM_001292034) Human Untagged Clone

Sign In for Pricing
View Details
ETV4 Protein Vector (Human) (pPM-C-HA)
PV014651 500 ng

ETV4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SEC23B Polyclonal Antibody
RD82017A-01 60 μL

SEC23B Polyclonal Antibody

Sign In for Pricing
View Details