Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Rat (HEK293, Fc)

CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-rat-hek293-fc.html

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE

Molecular Formula

307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)

Molecular Weight

Approximately 106-116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAI14 Human qPCR Primer Pair (NM_015577)
HP211714 200 Reactions

RAI14 Human qPCR Primer Pair (NM_015577)

Sign In for Pricing
View Details
Mouse Monoclonal A20/TNFAIP3 Antibody (59A426) [HRP]
NBP1-77533H 0.1 mL

Mouse Monoclonal A20/TNFAIP3 Antibody (59A426) [HRP]

Sign In for Pricing
View Details
KIR3.1 Antibody
abx216379-01 50 µL

KIR3.1 Antibody

Sign In for Pricing
View Details
KIR3.1 Antibody
abx216379-02 100 µL

KIR3.1 Antibody

Sign In for Pricing
View Details
CD42b Antibody (Biotin)
GWB-902EF2 0.02 mg

CD42b Antibody (Biotin)

Sign In for Pricing
View Details
ERCC8 (DNA Excision Repair Protein ERCC-8, Cockayne Syndrome WD Repeat Protein CSA, CKN1, CSA) (APC)
126435-APC 100 µL

ERCC8 (DNA Excision Repair Protein ERCC-8, Cockayne Syndrome WD Repeat Protein CSA, CKN1, CSA) (APC)

Sign In for Pricing
View Details