Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Rat (HEK293, Fc)

CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-rat-hek293-fc.html

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE

Molecular Formula

307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)

Molecular Weight

Approximately 106-116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2B3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H1]
TA503537BM 100 µL

EIF2B3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H1]

Sign In for Pricing
View Details
Rabbit Anti-Human FOXP1 pAb
PA13923-01 50 μL

Rabbit Anti-Human FOXP1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human FOXP1 pAb
PA13923-02 100 μL

Rabbit Anti-Human FOXP1 pAb

Sign In for Pricing
View Details
PCDH-CMV-CNTNAP3EF1A-EGFP-T2A-PURO
BZ0488-2 1 Vial

PCDH-CMV-CNTNAP3EF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
MEIS1 siRNA (Human)
CRH2863-01 15 nmol

MEIS1 siRNA (Human)

Sign In for Pricing
View Details
MEIS1 siRNA (Human)
CRH2863-02 30 nmol

MEIS1 siRNA (Human)

Sign In for Pricing
View Details