Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF1R, Rat (HEK293, Fc)

CSF1R Protein is a cell surface receptor with high a affinity for a variety of polypeptide growth factors, cytokines, and hormones. CSF1R Protein participate in PLCG2/PKA/UCP2 signaling pathway to reduce oxidative stress and neuronal apoptosis in rat models with neonatal HIE. The blocking of the CSF1R signal is associated with tumorigenesis. CSF1R Protein, Rat (HEK293, Fc) is the recombinant rat-derived CSF1R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CSF1R Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/csf1r-protein-rat-hek293-fc.html

Smiles

MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSAWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDE

Molecular Formula

307403 (Gene_ID) D4ACA7 (L21-E510) (Accession)

Molecular Weight

Approximately 106-116 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chemokine C-X-C-Motif Ligand 16
RPU61337-01 50 µg

Mouse Chemokine C-X-C-Motif Ligand 16

Sign In for Pricing
View Details
Mouse Chemokine C-X-C-Motif Ligand 16
RPU61337-02 100 µg

Mouse Chemokine C-X-C-Motif Ligand 16

Sign In for Pricing
View Details
Mouse Chemokine C-X-C-Motif Ligand 16
RPU61337-03 1 mg

Mouse Chemokine C-X-C-Motif Ligand 16

Sign In for Pricing
View Details
Cep76 (NM_001081073) Mouse Untagged Clone
MC220202 10 µg

Cep76 (NM_001081073) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Dihydroorotase (pyrC)
MBS1023598-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Dihydroorotase (pyrC)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Dihydroorotase (pyrC)
MBS1023598-02 0.02 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Dihydroorotase (pyrC)

Sign In for Pricing
View Details