Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-A1/EFNA1, Human (HEK293, Fc)

The Ephrin-A1/EFNA1 protein is a GPI-binding ligand that interacts with Eph receptors and is critical for migration and adhesion. It recruits VAV2, VAV3, and PI3 kinase p85 subunits through EPHA2 phosphorylation, activating RAC1 GTPase for endothelial cell migration. Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Ephrin-A1/EFNA1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-a1-efna1-protein-human-hek-293-fc.html

Purity

95

Smiles

DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS

Molecular Formula

1942 (Gene_ID) P20827-1 (D19-S182) (Accession)

Molecular Weight

Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-500 1x 500 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-500 1x 500 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL
BNC942171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF568 conjugate, 0.1mg/mL
BNC680979-500 1x 500 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details