Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2B, Mouse (HEK293, His)

ACVR2B is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2B binds to activins and growth differentiation factors (GDF), which in turn activate type I receptors, activating downstream molecule SMAD2/3[1]. ACVR2B Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 134 amino acids (M1-T134) .

Product Specifications

Product Name Alternative

ACVR2B Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acvr2b-protein-mouse-hek293-his.html

Purity

90.00

Smiles

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPT

Molecular Formula

11481 (Gene_ID) P27040-1 (S19-T134) (Accession)

Molecular Weight

23-37 kDa

References & Citations

[1]Johanna Magga, et al. Systemic Blockade of ACVR2B Ligands Protects Myocardium from Acute Ischemia-Reperfusion Injury. Mol Ther. 2019 Mar 6;27 (3) :600-610.|[2]Oddrun Elise Olsen, et al. Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B. Cell Commun Signal. 2015 Jun 6;13:27.|[3]Rafael Barreto, et al. ACVR2B/Fc counteracts chemotherapy-induced loss of muscle and bone mass. Sci Rep. 2017 Oct 31;7 (1) :14470.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC38 shRNA (h) Lentiviral Particles
sc-95669-V 200 µL

CCDC38 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Human Olfactory receptor 56A3 (OR56A3) ELISA kit
GTR10393982 96 Well

Human Olfactory receptor 56A3 (OR56A3) ELISA kit

Sign In for Pricing
View Details
Rat GP5 siRNA
abx918312-01 15 nmol

Rat GP5 siRNA

Sign In for Pricing
View Details
Rat GP5 siRNA
abx918312-02 30 nmol

Rat GP5 siRNA

Sign In for Pricing
View Details
PK11007
BA3464-10 10 mg

PK11007

Sign In for Pricing
View Details
Rat glial cell line-derived neurotrophic factor, GDNF ELISA KIT
YLA0057RA-01 48 Tests

Rat glial cell line-derived neurotrophic factor, GDNF ELISA KIT

Sign In for Pricing
View Details