Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Mouse

GM-CSF Protein is a hematopoietic growth factor and immunomodulator. By binding to specific receptors on the surface of target cells, GM-CSF Protein activates intracellular signaling pathways to regulate cell proliferation, differentiation, maturation, and function. GM-CSF Protein plays an important role in the hematopoietic process and the immune system. GM-CSF Protein, Mouse is a recombinant GM-CSF Protein expressed by E. coli without a tag[1][2][3][4].

Product Specifications

Product Name Alternative

GM-CSF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-mouse.html

Purity

98.00

Smiles

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Molecular Formula

12981 (Gene_ID) Q14AD9 (A18-K141) (Accession)

Molecular Weight

Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Shi Y, et al. Granulocyte-macrophage colony-stimulating factor (GM-CSF) and T-cell responses: what we do and don't know. Cell Res. 2006 Feb;16 (2) :126-33.|[2]Gasson JC, et al. Human granulocyte-macrophage colony-stimulating factor (GM-CSF) : regulation of expression. Prog Clin Biol Res. 1990;338:27-41.|[3]Gomez-Cambronero J, et al. Granulocyte-macrophage colony-stimulating factor is a chemoattractant cytokine for human neutrophils: involvement of the ribosomal p70 S6 kinase signaling pathway. J Immunol. 2003 Dec 15;171 (12) :6846-55.|[4]Shiomi A, et al. GM-CSF as a therapeutic target in autoimmune diseases. Inflamm Regen. 2016 Jul 5;36:8.|[5]Na YR, et al. GM-CSF Induces Inflammatory Macrophages by Regulating Glycolysis and Lipid Metabolism. J Immunol. 2016 Nov 15;197 (10) :4101-4109. doi: 10.4049/jimmunol.1600745IF: 3.6 Q2 . Epub 2016 Oct 14. Erratum in: J Immunol. 2017 Apr 1;198 (7) :3000.|[6]Reed J A, et al. Aerosolized GM-CSF ameliorates pulmonary alveolar proteinosis in GM-CSF-deficient mice[J]. American Journal of Physiology-Lung Cellular and Molecular Physiology, 1999, 276 (4) : L556-L563.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Testis-specific Y-encoded-Like protein 4 (TSPYL4) Mouse ELISA Kit
H5230 96 Tests

Testis-specific Y-encoded-Like protein 4 (TSPYL4) Mouse ELISA Kit

Sign In for Pricing
View Details
CD8A (T-cell Surface Glycoprotein CD8 alpha Chain, T-lymphocyte Differentiation Antigen T8/Leu-2, CD8a, MAL) (MaxLight 750)
MBS6373321-01 0.1 mL

CD8A (T-cell Surface Glycoprotein CD8 alpha Chain, T-lymphocyte Differentiation Antigen T8/Leu-2, CD8a, MAL) (MaxLight 750)

Sign In for Pricing
View Details
CD8A (T-cell Surface Glycoprotein CD8 alpha Chain, T-lymphocyte Differentiation Antigen T8/Leu-2, CD8a, MAL) (MaxLight 750)
MBS6373321-02 5x 0.1 mL

CD8A (T-cell Surface Glycoprotein CD8 alpha Chain, T-lymphocyte Differentiation Antigen T8/Leu-2, CD8a, MAL) (MaxLight 750)

Sign In for Pricing
View Details
LOC100503276 3'UTR GFP Stable Cell Line
TU161755 1.0 mL

LOC100503276 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Genomic DNA - Human Diabetic Diseased Tissue: Adrenal, from a single donor
D1236004Dia 50 µg

Genomic DNA - Human Diabetic Diseased Tissue: Adrenal, from a single donor

Sign In for Pricing
View Details
Recombinant Bacillus cereus Bifunctional protein GlmU (glmU)
MBS1141171-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Bifunctional protein GlmU (glmU)

Sign In for Pricing
View Details