Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kallikrein-5, Human (HEK293, C-His)

The Kallikrein-5 protein may be involved in desquamation, suggesting a role in the process of skin shedding and exfoliation. Its association with desquamation suggests that it plays a role in regulating the removal of dead skin cells, which is critical for skin homeostasis. Kallikrein-5 Protein, Human (HEK293, C-His) is the recombinant human-derived Kallikrein-5 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Kallikrein-5 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kallikrein-5-protein-human-hek293-c-his.html

Purity

96.00

Smiles

VTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

Molecular Formula

25818 (Gene_ID) Q9Y337 (V23-S293) (Accession)

Molecular Weight

Approximately 35-44 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HN1L (Hematological and Neurological Expressed 1-like, C16orf34, FLJ13092, KIAA1426, L11) (MaxLight 490)
MBS6206686-01 0.1 mL

HN1L (Hematological and Neurological Expressed 1-like, C16orf34, FLJ13092, KIAA1426, L11) (MaxLight 490)

Sign In for Pricing
View Details
HN1L (Hematological and Neurological Expressed 1-like, C16orf34, FLJ13092, KIAA1426, L11) (MaxLight 490)
MBS6206686-02 5x 0.1 mL

HN1L (Hematological and Neurological Expressed 1-like, C16orf34, FLJ13092, KIAA1426, L11) (MaxLight 490)

Sign In for Pricing
View Details
Phospho-Mcl1 (Ser159 + Thr163) Rabbit Polyclonal Antibody (BF594)
orb1605546 100 µL

Phospho-Mcl1 (Ser159 + Thr163) Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila adk Protein
VAng-Lsx0944-1mgEcoli 1 mg (E. coli)

Recombinant Aeromonas Hydrophila adk Protein

Sign In for Pricing
View Details
Bovine CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit
MBS7218834-01 48 Well

Bovine CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit

Sign In for Pricing
View Details
Bovine CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit
MBS7218834-02 96 Well

Bovine CCR4-NOT transcription complex subunit 3 (CNOT3) ELISA Kit

Sign In for Pricing
View Details