Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) (Active)

Product Specifications

Product Name Alternative

Protein FAM60A (Tera protein homolog) (C12orf14) (FAM60A)

Abbreviation

Recombinant Human SINHCAF protein (Active)

Gene Name

SINHCAF

UniProt

Q9NP50

Expression Region

1-221aa

Organism

Homo sapiens (Human)

Target Sequence

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Tag

N-terminal GST-tagged

Type

Active Protein & Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Subunit of the Sin3 deacetylase complex, this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway . Core component of a SIN3A complex present in embryonic stem cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized LCN2 at 2 μg/ml can bind human SINHCAF, the EC50 of human SINHCAF protein is 31.54-38.59 μg/ml.

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMAN1 Protein Vector (Mouse) (pPM-C-HA)
PV196888 500 ng

LMAN1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Tigd2 ORF Vector (Mouse) (pORF)
ORF059576 1.0 µg DNA

Tigd2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
EMILIN2 (EMILIN-2, Elastin Microfibril Interface-located Protein 2, Elastin Microfibril Interfacer 2, Protein FOAP-10, FLJ33200) (MaxLight 405)
MBS6189977-01 0.1 mL

EMILIN2 (EMILIN-2, Elastin Microfibril Interface-located Protein 2, Elastin Microfibril Interfacer 2, Protein FOAP-10, FLJ33200) (MaxLight 405)

Sign In for Pricing
View Details
EMILIN2 (EMILIN-2, Elastin Microfibril Interface-located Protein 2, Elastin Microfibril Interfacer 2, Protein FOAP-10, FLJ33200) (MaxLight 405)
MBS6189977-02 5x 0.1 mL

EMILIN2 (EMILIN-2, Elastin Microfibril Interface-located Protein 2, Elastin Microfibril Interfacer 2, Protein FOAP-10, FLJ33200) (MaxLight 405)

Sign In for Pricing
View Details
CD116/CSF2RA Human Monoclonal Antibody (PerCP)
orb2972010-01 50 Tests

CD116/CSF2RA Human Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details
CD116/CSF2RA Human Monoclonal Antibody (PerCP)
orb2972010-02 100 Tests

CD116/CSF2RA Human Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details