Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM-CSF, Canine

The CSF2 protein is a cytokine that plays a critical role in the regulation of immune responses and hematopoiesis. It stimulates the production and differentiation of white blood cells, including macrophages and granulocytes. GM-CSF Protein, Canine is the recombinant canine-derived GM-CSF protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

GM-CSF Protein, Canine, Canine, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gm-csf-protein-canine.html

Purity

95.0

Smiles

APTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDCWKPVKK

Molecular Formula

403923 (Gene_ID) P48749 (A18-K144) (Accession)

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Lymphocyte Antigen 96 ELISA Kit
MBS747291-01 48 Well

Canine Lymphocyte Antigen 96 ELISA Kit

Sign In for Pricing
View Details
Canine Lymphocyte Antigen 96 ELISA Kit
MBS747291-02 96 Well

Canine Lymphocyte Antigen 96 ELISA Kit

Sign In for Pricing
View Details
Canine Lymphocyte Antigen 96 ELISA Kit
MBS747291-03 5x 96 Well

Canine Lymphocyte Antigen 96 ELISA Kit

Sign In for Pricing
View Details
Canine Lymphocyte Antigen 96 ELISA Kit
MBS747291-04 10x 96 Well

Canine Lymphocyte Antigen 96 ELISA Kit

Sign In for Pricing
View Details
Anti-Mouse CD22-SPRD Conjugate Antibody
MBS4151638-01 0.1 mg

Anti-Mouse CD22-SPRD Conjugate Antibody

Sign In for Pricing
View Details
Anti-Mouse CD22-SPRD Conjugate Antibody
MBS4151638-02 5x 0.1 mg

Anti-Mouse CD22-SPRD Conjugate Antibody

Sign In for Pricing
View Details