Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIP-3 alpha/CCL20, Human

MIP-3 alpha/CCL20 Protein, Human is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Human is a recombinant human CCL20 (A27-M96) expressed by E. coli[1].

Product Specifications

Product Name Alternative

MIP-3 alpha/CCL20 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mip-3-alpha-ccl20-protein-human.html

Purity

97.00

Smiles

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Molecular Formula

6364 (Gene_ID) P78556-1 (A27-M96) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Skovdahl HK, et al. C-C Motif Ligand 20 (CCL20) and C-C Motif Chemokine Receptor 6 (CCR6) in Human Peripheral Blood Mononuclear Cells: Dysregulated in Ulcerative Colitis and a Potential Role for CCL20 in IL-1β Release. Int J Mol Sci. 2018 Oct 20;19 (10) .|[2]Benkheil M, et al. CCL20, a direct-acting pro-angiogenic chemokine induced by hepatitis C virus (HCV) : Potential role in HCV-related liver cancer. Exp Cell Res. 2018 Nov 15;372 (2) :168-177.|[3]Louis Boafo Kwantwi, et al. Multifaceted roles of CCL20 (C-C motif chemokine ligand 20) : mechanisms and communication networks in breast cancer progression. Bioengineered. 2021 Dec;12 (1) :6923-6934.|[4]M Baba, et al. Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC. J Biol Chem. 1997 Jun 6;272 (23) :14893-8.|[5]M Soledad Hielpos, et al. CCL20 and Beta-Defensin 2 Production by Human Lung Epithelial Cells and Macrophages in Response to Brucella abortus Infection. PLoS One. 2015 Oct 8;10 (10) :e0140408.|[6]A Izadpanah, et al. Regulated MIP-3alpha/CCL20 production by human intestinal epithelium: mechanism for modulating mucosal immunity. Am J Physiol Gastrointest Liver Physiol. 2001 Apr;280 (4) :G710-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SLC36A2 Antibody [Alexa Fluor 647]
NBP2-81904AF647 0.1 mL

Rabbit Polyclonal SLC36A2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
PGK2 Rabbit Polyclonal Antibody (Fluoro647)
orb3097985 100 µg

PGK2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Lentiviral human PROCR shRNA (UAS) - Lentiviral human PROCR shRNA (UAS, RFP) (100)
GTR15322875 1 Vial

Lentiviral human PROCR shRNA (UAS) - Lentiviral human PROCR shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
GSK-3β inhibitor 22
orb2814097-01 25 mg

GSK-3β inhibitor 22

Sign In for Pricing
View Details
GSK-3β inhibitor 22
orb2814097-02 50 mg

GSK-3β inhibitor 22

Sign In for Pricing
View Details
GSK-3β inhibitor 22
orb2814097-03 100 mg

GSK-3β inhibitor 22

Sign In for Pricing
View Details