Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Y-box-binding protein 2 (YBX2)

Product Specifications

Product Name Alternative

(Contrin) (DNA-binding protein C) (Dbpc) (Germ cell-specific Y-box-binding protein) (MSY2 homolog)

Abbreviation

Recombinant Human YBX2 protein

Gene Name

YBX2

UniProt

Q9Y2T7

Expression Region

1-364aa

Organism

Homo sapiens (Human)

Target Sequence

MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Major constituent of messenger ribonucleoprotein particles (mRNPs) . Involved in the regulation of the stability and/or translation of germ cell mRNAs. Binds to Y-box consensus promoter element. Binds to full-length mRNA with high affinity in a sequence-independent manner. Binds to short RNA sequences containing the consensus site 5'-UCCAUCA-3' with low affinity and limited sequence specificity. Its binding with maternal mRNAs is necessary for its cytoplasmic retention. May mark specific mRNAs (those transcribed from Y-box promoters) in the nucleus for cytoplasmic storage, thereby linking transcription and mRNA storage/translational delay.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdlim4 (NM_019417) Mouse Tagged Lenti ORF Clone
MR204849L4 10 µg

Pdlim4 (NM_019417) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti-Human BDNF Polyclonal
MBS807679-01 0.1 mg

Rabbit Anti-Human BDNF Polyclonal

Sign In for Pricing
View Details
Rabbit Anti-Human BDNF Polyclonal
MBS807679-02 5x 0.1 mg

Rabbit Anti-Human BDNF Polyclonal

Sign In for Pricing
View Details
Mouse Monoclonal CCL8/MCP-2 Antibody (35509.11) [Alexa Fluor 594]
NB120-10391AF594 0.1 mL

Mouse Monoclonal CCL8/MCP-2 Antibody (35509.11) [Alexa Fluor 594]

Sign In for Pricing
View Details
Chicken Cyclooxygenase 2 ELISA kit
GTR10473607 96 Well

Chicken Cyclooxygenase 2 ELISA kit

Sign In for Pricing
View Details
CD41 Mouse mAb
MBS4753763-01 0.1 mL

CD41 Mouse mAb

Sign In for Pricing
View Details