Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSK-3 beta, Human (P. pastoris, His)

GSK-3 beta is an active protein kinase that regulates a variety of cellular processes. It negatively regulates glucose homeostasis, Wnt signaling, and transcription factors by phosphorylating substrates such as glycogen synthase, CTNNB1, and JUN. GSK-3 beta Protein, Human (P. pastoris, His) is the recombinant human-derived GSK-3 beta protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GSK-3 beta Protein, Human (P. pastoris, His), Human, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gsk-3-beta-protein-human-p-pastoris-his.html

Purity

90.0

Smiles

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Molecular Formula

2932 (Gene_ID) P49841-1 (M1-T420) (Accession)

Molecular Weight

50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THBS1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
46641151 3x 1.0 µg DNA

THBS1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Nmt2 (NM_001290369) Mouse Tagged ORF Clone
MR230152 10 µg

Nmt2 (NM_001290369) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ACE2 Antibody
orb1558068-01 50 μL

ACE2 Antibody

Sign In for Pricing
View Details
ACE2 Antibody
orb1558068-02 100 µL

ACE2 Antibody

Sign In for Pricing
View Details
ACE2 Antibody
orb1558068-03 200 µL

ACE2 Antibody

Sign In for Pricing
View Details
Rat Monoclonal BAFF/BLyS/TNFSF13B Antibody (121808) [DyLight 650]
FAB1357W 0.1 mL

Rat Monoclonal BAFF/BLyS/TNFSF13B Antibody (121808) [DyLight 650]

Sign In for Pricing
View Details