Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF677 Protein Lysate (Human) with C-Ha Tag
51721031 100 µg

ZNF677 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Glycine Receptor, alpha1
MBS614151-01 0.2 mg

Glycine Receptor, alpha1

Sign In for Pricing
View Details
Glycine Receptor, alpha1
MBS614151-02 5x 0.2 mg

Glycine Receptor, alpha1

Sign In for Pricing
View Details
Gm773 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3170408 1.0 µg DNA

Gm773 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-BTBD1 antibody
STJ26853 100 µl

Anti-BTBD1 antibody

Sign In for Pricing
View Details
RSV (Respiratory Syncytial Virus) (FITC)
MBS6450412-01 0.1 mL

RSV (Respiratory Syncytial Virus) (FITC)

Sign In for Pricing
View Details