Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sptbn4 (NM_001199234) Mouse Tagged ORF Clone
MR231721 10 µg

Sptbn4 (NM_001199234) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Sirtuin 1/SIRT1 Antibody (PCRP-SIRT1-1E11) [Alexa Fluor 350]
NBP3-14290AF350 0.1 mL

Mouse Monoclonal Sirtuin 1/SIRT1 Antibody (PCRP-SIRT1-1E11) [Alexa Fluor 350]

Sign In for Pricing
View Details
Human Infectious Bronchitis Antibody,IBV ELISA KIT
JOT-EKD0121Hu 96 wells

Human Infectious Bronchitis Antibody,IBV ELISA KIT

Sign In for Pricing
View Details
Mycobacterium tuberculosis antigen 14/16 Chimeric Protein, Recombinant
048853 100 µg

Mycobacterium tuberculosis antigen 14/16 Chimeric Protein, Recombinant

Sign In for Pricing
View Details
EML1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0678405 3x 1.0 µg

EML1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human CD273 (B7-DC, PD-L2) Mouse mAb
E47M30107 100 µL

Human CD273 (B7-DC, PD-L2) Mouse mAb

Sign In for Pricing
View Details