Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Arhgef12 Pre-designed siRNA Set A
SI200878A 1 Each

Rat Arhgef12 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human MAP3K11 shRNA (UAS) - Lentiviral human MAP3K11 shRNA (UAS, GFP) (100)
GTR15332292 1 Vial

Lentiviral human MAP3K11 shRNA (UAS) - Lentiviral human MAP3K11 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit Monoclonal CD35 Antibody (CR1/8283R) - Azide and BSA Free
NBP3-24269 100 µg

Rabbit Monoclonal CD35 Antibody (CR1/8283R) - Azide and BSA Free

Sign In for Pricing
View Details
Rabbit Polyclonal NCKAP5L Antibody [Biotin]
NBP3-18505B 0.1 mL

Rabbit Polyclonal NCKAP5L Antibody [Biotin]

Sign In for Pricing
View Details
Anti-6 X His Tag (HHHHHH) Monoclonal Antibody (1A056)
MBS1579632-01 0.05 mg

Anti-6 X His Tag (HHHHHH) Monoclonal Antibody (1A056)

Sign In for Pricing
View Details
Anti-6 X His Tag (HHHHHH) Monoclonal Antibody (1A056)
MBS1579632-02 0.1 mg

Anti-6 X His Tag (HHHHHH) Monoclonal Antibody (1A056)

Sign In for Pricing
View Details