Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Box of 250 Sheets of Weighing Paper 45G/M2, 150X150 Mm
PE45F1515Z Box of 250

Box of 250 Sheets of Weighing Paper 45G/M2, 150X150 Mm

Sign In for Pricing
View Details
Laminin γ-3 shRNA Plasmid (h)
sc-35786-SH 20 µg

Laminin γ-3 shRNA Plasmid (h)

Sign In for Pricing
View Details
PEX19 (NM_002857) Human Tagged ORF Clone Lentiviral Particle
RC201756L4V 200 µL

PEX19 (NM_002857) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SENP1 Polyclonal Antibody
E55A02588 100 µg

SENP1 Polyclonal Antibody

Sign In for Pricing
View Details
H17B6 rabbit pAb
RA25616-01 50 µL

H17B6 rabbit pAb

Sign In for Pricing
View Details
H17B6 rabbit pAb
RA25616-02 100 µL

H17B6 rabbit pAb

Sign In for Pricing
View Details