Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-10RB Recombinant Rabbit monoclonal Antibody
HA725296 100 µL

Human IL-10RB Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ADIPOQ (11V7) Mouse Monoclonal antibody
E28PE0951 100 µL

ADIPOQ (11V7) Mouse Monoclonal antibody

Sign In for Pricing
View Details
PAX1, NT (PAX1, HUP48, Paired box protein Pax-1, HuP48)
MBS6008608-01 0.2 mL

PAX1, NT (PAX1, HUP48, Paired box protein Pax-1, HuP48)

Sign In for Pricing
View Details
PAX1, NT (PAX1, HUP48, Paired box protein Pax-1, HuP48)
MBS6008608-02 5x 0.2 mL

PAX1, NT (PAX1, HUP48, Paired box protein Pax-1, HuP48)

Sign In for Pricing
View Details
Rabbit Polyclonal PAGE3 Antibody
NBP2-49362-25ul 25 µL

Rabbit Polyclonal PAGE3 Antibody

Sign In for Pricing
View Details
STK38 (Serine/Threonine Kinase 38, Ndr Ser/Thr Kinase-like Protein, OTTHUMP00000016293, Nuclear Dbf2-related 1, Serine Threonine Protein Kinase, NDR, NDR1) (MaxLight 750)
MBS6236999-01 0.1 mL

STK38 (Serine/Threonine Kinase 38, Ndr Ser/Thr Kinase-like Protein, OTTHUMP00000016293, Nuclear Dbf2-related 1, Serine Threonine Protein Kinase, NDR, NDR1) (MaxLight 750)

Sign In for Pricing
View Details