Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSS sgRNA CRISPR Lentivector (Human) (Target 1)
K0530902 1.0 µg DNA

CTSS sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
pOTB7-ADPGK Plasmid
PVT31296 2 µg

pOTB7-ADPGK Plasmid

Sign In for Pricing
View Details
5'-Nucleotidase (CD73, CD73 Antigen, Ecto-5'nucleotidase, 5'-NT, eN, eNT, NT5, NT5E, NTE, Purine 5 Prime Nucleotidase) (MaxLight 650)
122766-ML650 100 µL

5'-Nucleotidase (CD73, CD73 Antigen, Ecto-5'nucleotidase, 5'-NT, eN, eNT, NT5, NT5E, NTE, Purine 5 Prime Nucleotidase) (MaxLight 650)

Sign In for Pricing
View Details
TCP1 Conjugated Antibody
MBS9443636-01 0.1 mL (Biotin)

TCP1 Conjugated Antibody

Sign In for Pricing
View Details
TCP1 Conjugated Antibody
MBS9443636-02 0.1 mL (AF350)

TCP1 Conjugated Antibody

Sign In for Pricing
View Details
TCP1 Conjugated Antibody
MBS9443636-03 0.1 mL (AF405)

TCP1 Conjugated Antibody

Sign In for Pricing
View Details