Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBP1, ID (UBP1, LBP1, Upstream-binding protein 1, Transcription factor LBP-1) (APC) discontinued
043549-APC 200 µL

UBP1, ID (UBP1, LBP1, Upstream-binding protein 1, Transcription factor LBP-1) (APC) discontinued

Sign In for Pricing
View Details
Monkey Small Intestine, Jejunum Total RNA, Rhesus
UR-308 0.1 mg

Monkey Small Intestine, Jejunum Total RNA, Rhesus

Sign In for Pricing
View Details
THUMPD2 Human qPCR Template Standard (NM_025264)
HK207322 1 Kit

THUMPD2 Human qPCR Template Standard (NM_025264)

Sign In for Pricing
View Details
1600012H06Rik Protein Vector (Mouse) (pPB-N-His)
PV146631 500 ng

1600012H06Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal TXNDC12 Antibody
NBP3-10018-100ul 100 µL

Rabbit Polyclonal TXNDC12 Antibody

Sign In for Pricing
View Details
SPATA19 sgRNA CRISPR Lentivector (Human) (Target 1)
K2268602 1.0 µg DNA

SPATA19 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details