Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IRF2BP2 Antibody [CoraFluor 1]
NBP2-81996CL1 0.1 mL

Rabbit Polyclonal IRF2BP2 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Recombinant Mouse JAK3 Protein, His (Fc)-Avi-tagged
JAK3-4669M 50 µg

Recombinant Mouse JAK3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
HAUS8, NT (HAUS8, HICE1, HAUS augmin-like complex subunit 8, HEC1/NDC80-interacting centrosome-associated protein 1, Sarcoma antigen NY-SAR-48) (APC)
MBS6305527-01 0.2 mL

HAUS8, NT (HAUS8, HICE1, HAUS augmin-like complex subunit 8, HEC1/NDC80-interacting centrosome-associated protein 1, Sarcoma antigen NY-SAR-48) (APC)

Sign In for Pricing
View Details
HAUS8, NT (HAUS8, HICE1, HAUS augmin-like complex subunit 8, HEC1/NDC80-interacting centrosome-associated protein 1, Sarcoma antigen NY-SAR-48) (APC)
MBS6305527-02 5x 0.2 mL

HAUS8, NT (HAUS8, HICE1, HAUS augmin-like complex subunit 8, HEC1/NDC80-interacting centrosome-associated protein 1, Sarcoma antigen NY-SAR-48) (APC)

Sign In for Pricing
View Details
PIN8 Antibody
PHY2273A 150 μg

PIN8 Antibody

Sign In for Pricing
View Details
PLOD2/LH2 Rabbit mAb
MBS9147688-01 0.02 mL

PLOD2/LH2 Rabbit mAb

Sign In for Pricing
View Details