Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAT1, CT (Acetyl-CoA Acetyltransferase, Mitochondrial, Acetoacetyl-CoA Thiolase, T2, ACAT, MAT) (AP) discontinued
A0219-90-AP 200 µL

ACAT1, CT (Acetyl-CoA Acetyltransferase, Mitochondrial, Acetoacetyl-CoA Thiolase, T2, ACAT, MAT) (AP) discontinued

Sign In for Pricing
View Details
Exosc3 Rat Pre-designed siRNA Set A
HY-RS27643 1 Set

Exosc3 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
COX4I2 siRNA (Rat)
MBS8240287-01 15 nmol

COX4I2 siRNA (Rat)

Sign In for Pricing
View Details
COX4I2 siRNA (Rat)
MBS8240287-02 30 nmol

COX4I2 siRNA (Rat)

Sign In for Pricing
View Details
COX4I2 siRNA (Rat)
MBS8240287-03 5x 30 nmol

COX4I2 siRNA (Rat)

Sign In for Pricing
View Details
Recombinant Rhizobium leguminosarum bv.viciae Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA), partial
MBS7075349 Inquire

Recombinant Rhizobium leguminosarum bv.viciae Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA), partial

Sign In for Pricing
View Details