Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-p70 S6 Kinase (Ser371) Recombinant Rabbit mAb (S-1239-6)
S0B0784-01 1 mL

Phospho-p70 S6 Kinase (Ser371) Recombinant Rabbit mAb (S-1239-6)

Sign In for Pricing
View Details
Phospho-p70 S6 Kinase (Ser371) Recombinant Rabbit mAb (S-1239-6)
S0B0784-02 25 µL

Phospho-p70 S6 Kinase (Ser371) Recombinant Rabbit mAb (S-1239-6)

Sign In for Pricing
View Details
Phospho-p70 S6 Kinase (Ser371) Recombinant Rabbit mAb (S-1239-6)
S0B0784-03 100 µL

Phospho-p70 S6 Kinase (Ser371) Recombinant Rabbit mAb (S-1239-6)

Sign In for Pricing
View Details
ROCK/HDAC-IN-2
HY-172177 1 Each

ROCK/HDAC-IN-2

Sign In for Pricing
View Details
HiPure Plasmid MaxiPrep Kit
abx298028 10 Reactions

HiPure Plasmid MaxiPrep Kit

Sign In for Pricing
View Details
TRAF2 polyclonal antibody
BS91371 50ul

TRAF2 polyclonal antibody

Sign In for Pricing
View Details