Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD68/SR-D1 Antibody (KP1)
TA336488 500 µL

Mouse Monoclonal CD68/SR-D1 Antibody (KP1)

Sign In for Pricing
View Details
ACSL3 Protein Vector (Mouse) (pPM-C-HA)
11215024 500 ng

ACSL3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Kpna6 ORF Vector (Rat) (pORF)
25905016 1.0 µg DNA

Kpna6 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
28 kDa heat- and Acid-stable phosphoprotein (PDAP1) Human ELISA Kit
B0428 96 Tests

28 kDa heat- and Acid-stable phosphoprotein (PDAP1) Human ELISA Kit

Sign In for Pricing
View Details
1- (1-benzofuran-2-yl) ethanamine
sc-272805 250 mg

1- (1-benzofuran-2-yl) ethanamine

Sign In for Pricing
View Details
Atp13a1 (NM_001106079) Rat Tagged ORF Clone
RR214705 10 µg

Atp13a1 (NM_001106079) Rat Tagged ORF Clone

Sign In for Pricing
View Details