Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Beta-2-microglobulin,B2M ELISA KIT
JOT-EK0035Ra 96 wells

Rat Beta-2-microglobulin,B2M ELISA KIT

Sign In for Pricing
View Details
Srgn Rat siRNA Oligo Duplex (Locus ID 56782)
SR513645 1 Kit

Srgn Rat siRNA Oligo Duplex (Locus ID 56782)

Sign In for Pricing
View Details
PKD1L3 Antibody
MBS7050567-01 0.05 mg

PKD1L3 Antibody

Sign In for Pricing
View Details
PKD1L3 Antibody
MBS7050567-02 0.1 mg

PKD1L3 Antibody

Sign In for Pricing
View Details
PKD1L3 Antibody
MBS7050567-03 5x 0.1 mg

PKD1L3 Antibody

Sign In for Pricing
View Details
GKP3 (Putative Glycerol Kinase 3, GK 3, Glycerokinase 3, ATP:glycerol 3-phosphotransferase 3, Glycerol Kinase, Testis Specific 1, GKP3, GKTB) (AP) discontinued
127331-AP 100 µL

GKP3 (Putative Glycerol Kinase 3, GK 3, Glycerokinase 3, ATP:glycerol 3-phosphotransferase 3, Glycerol Kinase, Testis Specific 1, GKP3, GKTB) (AP) discontinued

Sign In for Pricing
View Details