Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-FGF R2 alpha DuoSet ELISA IC 2 Plate
DYC684-2 2 Plates

Phospho-FGF R2 alpha DuoSet ELISA IC 2 Plate

Sign In for Pricing
View Details
St6galnac2 (NM_001031652) Rat Tagged ORF Clone
RR209088 10 µg

St6galnac2 (NM_001031652) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Skint5 shRNA (UAS) - Lentiviral mouse Skint5 shRNA (UAS, RFP) (25)
GTR15304562 1 Vial

Lentiviral mouse Skint5 shRNA (UAS) - Lentiviral mouse Skint5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-PDHA1 Antibody (R3A94)
RHC33505 100 μg

Anti-PDHA1 Antibody (R3A94)

Sign In for Pricing
View Details
Rabbit Polyclonal AlphaA Crystallin/CRYAA Antibody
NBP2-55161 100 µL

Rabbit Polyclonal AlphaA Crystallin/CRYAA Antibody

Sign In for Pricing
View Details
Human Neurotrophin-3, NT-3 ELISA Kit
MBS161637-01 48 Well

Human Neurotrophin-3, NT-3 ELISA Kit

Sign In for Pricing
View Details