Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin Beta Chain, Non-Erythrocytic 4 (SPTBN4) Antibody (PE/ATTO 594)
abx443893 100 µg

Spectrin Beta Chain, Non-Erythrocytic 4 (SPTBN4) Antibody (PE/ATTO 594)

Sign In for Pricing
View Details
Clathrin light chain A (CLTA) Human ELISA Kit
C3946 96 Tests

Clathrin light chain A (CLTA) Human ELISA Kit

Sign In for Pricing
View Details
SP1 (Sp1 Transcription Factor) (Biotin)
251993-Biotin 100 µL

SP1 (Sp1 Transcription Factor) (Biotin)

Sign In for Pricing
View Details
Lpcat2 3'UTR GFP Stable Cell Line
TU262492 1.0 mL

Lpcat2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SSA-60/Ro, Recombinant, Human, Western Blot Control (Sjogren Syndrome Antigen A 60kD, RO60, RoRNP, Ro 60kD Autoantigen)
S6600-75A 100 µL

SSA-60/Ro, Recombinant, Human, Western Blot Control (Sjogren Syndrome Antigen A 60kD, RO60, RoRNP, Ro 60kD Autoantigen)

Sign In for Pricing
View Details
2-Ethyl-2-methylpentanoic Acid-d3
417563-01 1 mg

2-Ethyl-2-methylpentanoic Acid-d3

Sign In for Pricing
View Details