Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella scrY Protein (aa 23-41)
VAng-Wyb1188-1mgEcoli 1 mg (E. coli)

Recombinant Salmonella scrY Protein (aa 23-41)

Sign In for Pricing
View Details
Lentiviral human ETFB shRNA (UAS) - Lentiviral human ETFB shRNA (UAS, iRFP) plasmid
GTR15117112 1 Vial

Lentiviral human ETFB shRNA (UAS) - Lentiviral human ETFB shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ZKSCAN1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF810966 100 µg

ZKSCAN1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

Sign In for Pricing
View Details
TYR Antibody (Center) Blocking Peptide
MBS9226813-01 0.5 mg

TYR Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
TYR Antibody (Center) Blocking Peptide
MBS9226813-02 5x 0.5 mg

TYR Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Fish MAGUK P55 Subfamily Member 2 (MPP2) ELISA Kit
MBS9365125 Inquire

Fish MAGUK P55 Subfamily Member 2 (MPP2) ELISA Kit

Sign In for Pricing
View Details