Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BOB1 Antibody (BOB1/2421) [DyLight 594]
NBP2-79885DL594 0.1 mL

Mouse Monoclonal BOB1 Antibody (BOB1/2421) [DyLight 594]

Sign In for Pricing
View Details
Recombinant Helicobacter Pylori cagA Protein (aa 918-1147)
VAng-Lsx3252-500gEcoli 500 µg (E. coli)

Recombinant Helicobacter Pylori cagA Protein (aa 918-1147)

Sign In for Pricing
View Details
NELL1 (Protein Kinase C-binding Protein NELL1, NEL-like Protein 1, Nel-related Protein 1, NRP1) (Biotin)
MBS6386866-01 0.1 mL

NELL1 (Protein Kinase C-binding Protein NELL1, NEL-like Protein 1, Nel-related Protein 1, NRP1) (Biotin)

Sign In for Pricing
View Details
NELL1 (Protein Kinase C-binding Protein NELL1, NEL-like Protein 1, Nel-related Protein 1, NRP1) (Biotin)
MBS6386866-02 5x 0.1 mL

NELL1 (Protein Kinase C-binding Protein NELL1, NEL-like Protein 1, Nel-related Protein 1, NRP1) (Biotin)

Sign In for Pricing
View Details
Anti Phosphatidylethanolamine Pab
111338 100 µg

Anti Phosphatidylethanolamine Pab

Sign In for Pricing
View Details
Amphiregulin (Schwannoma-derived Growth Factor, Amphiregulin Precursor, AR, Colorectum Cell-derived Growth Factor, CRDGF, MGC13647, SDGF) discontinued
A1590 500 µL

Amphiregulin (Schwannoma-derived Growth Factor, Amphiregulin Precursor, AR, Colorectum Cell-derived Growth Factor, CRDGF, MGC13647, SDGF) discontinued

Sign In for Pricing
View Details