Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNPO2L Human shRNA Lentiviral Particle (Locus ID 79933)
TL317493V 500 µL Each

SYNPO2L Human shRNA Lentiviral Particle (Locus ID 79933)

Sign In for Pricing
View Details
Mouse Monoclonal B3GALNT2 Antibody (OTI1G2) [DyLight 405]
NBP2-72411V 0.1 mL

Mouse Monoclonal B3GALNT2 Antibody (OTI1G2) [DyLight 405]

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2085281-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2085281-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2085281-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Misato Homolog 1 (MSTO1)
MBS2085281-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Misato Homolog 1 (MSTO1)

Sign In for Pricing
View Details