Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stratifin, Human (N-His, C-Myc)

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human (N-His, C-Myc) is the recombinant human-derived Stratifin protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Stratifin Protein, Human (N-His, C-Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stratifin-protein-human-n-his-c-myc.html

Purity

97.00

Smiles

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Molecular Formula

2810 (Gene_ID) P31947-1 (M1-S248) (Accession)

Molecular Weight

Approximately 34 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Galectin-4 / LGALS4 / L36LBP Protein, His Tag
GA4-H5246-1mg 1 mg

Human Galectin-4 / LGALS4 / L36LBP Protein, His Tag

Sign In for Pricing
View Details
SDCCAG1 antibody
70R-20128 50 ul

SDCCAG1 antibody

Sign In for Pricing
View Details
Mouse Monoclonal IL-22BP/IL22 RA2 Antibody (MM0397-6G47) [Alexa Fluor 750]
NBP2-11700AF750 0.1 mL

Mouse Monoclonal IL-22BP/IL22 RA2 Antibody (MM0397-6G47) [Alexa Fluor 750]

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans C45G9.10 Protein (aa 1-971)
VAng-Ly3173-inquire Inquire

Recombinant Caenorhabditis Elegans C45G9.10 Protein (aa 1-971)

Sign In for Pricing
View Details
Recombinant Escherichia coli potB Protein (aa 1-275)
VAng-Lsx02563-inquire Inquire

Recombinant Escherichia coli potB Protein (aa 1-275)

Sign In for Pricing
View Details
Compound NP-007652
MBS5790358 Inquire

Compound NP-007652

Sign In for Pricing
View Details