Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC5A/MDL-1, Rhesus Macaque (HEK293, His)

CLEC5A Protein is a cell surface receptor that signals via TYROBP, and functions as a positive regulator of osteoclastogenesis. CLEC5A Protein regulates inflammatory responses. CLEC5A/MDL-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

CLEC5A/MDL-1 Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec5a-mdl-1-protein-rhesus-macaque-hek293-his.html

Purity

96.00

Smiles

PQIFNKSNDGFTTTRSYGTDSQIFGSSSPSPNGFIPTRSYGTVCPEDWEFYQERCFLLPTSESSWNESRDFCKRKGSTLAIVNTPEKLKFLQDIADTEKYFIGLIYNREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDIRYRRICEKNAK

Molecular Formula

695425 (Gene_ID) XP_001085243 (P28-K188) (Accession)

Molecular Weight

Approximately 25-45 kDa due to the glycosylation.

References & Citations

[1]Watson AA, et al. Structural flexibility of the macrophage dengue virus receptor CLEC5A: implications for ligand binding and signaling. J Biol Chem. 2011;286 (27) :24208-24218.|[2]Chen ST, et al. CLEC5A is critical for dengue-virus-induced lethal disease. Nature. 2008;453 (7195) :672-676.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin L1 (CTSL1) Canine ELISA Kit
C1885 96 Tests

Cathepsin L1 (CTSL1) Canine ELISA Kit

Sign In for Pricing
View Details
Lentiviral human PLD2 shRNA (UAS) - Lentiviral human PLD2 shRNA (UAS) (100)
GTR15152670 1 Vial

Lentiviral human PLD2 shRNA (UAS) - Lentiviral human PLD2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Fam158a 3'UTR Lenti-reporter-Luc Vector
19806084 1.0 µg

Fam158a 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
IFI-16 discontinued
343874-01 100 µL

IFI-16 discontinued

Sign In for Pricing
View Details
IFI-16 discontinued
343874-02 200 µL

IFI-16 discontinued

Sign In for Pricing
View Details
Human αFP ELISA Kit
TDEH10304 96 Tests

Human αFP ELISA Kit

Sign In for Pricing
View Details