Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-12, Human (HEK293, His, Flag)

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells) . IL-12 Protein, Human (HEK293, His, Flag) is a recombinant protein dimer complex containing human-derived IL-12 beta & IL-12 alpha Heterodimer protein, expressed by HEK293 , with C-10*His, C-Flag labeled tag. IL-12 Protein, Human (HEK293, His, Flag), has molecular weight of 39.7 kDa & 27.2 kDa.

Product Specifications

Product Name Alternative

IL-12 Protein, Human (HEK293, His, Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-12-beta-il-12-alpha-heterodimer-protein-human-hek293-his-flag.html

Smiles

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Molecular Formula

3592&3593 (Gene_ID) P29459 (R23-S219) &P29460 (I23-S328) (Accession)

Molecular Weight

39.7 kDa & 27.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VGF Nerve Growth Factor Inducible (VGF) ELISA Kit
EKU08139 96 Tests

Human VGF Nerve Growth Factor Inducible (VGF) ELISA Kit

Sign In for Pricing
View Details
SERTAD2 Polyclonal Antibody, FITC Conjugated
bs-6398R-FITC 100 µL

SERTAD2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
PMS2P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV772918 1.0 µg DNA

PMS2P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rab11-FIP4 discontinued
393593 200 µL

Rab11-FIP4 discontinued

Sign In for Pricing
View Details
(4S,5R) -4,5-Diphenyl-2- (quinolin-2-yl) -4,5-dihydrooxazole
OR1008272-01 100 mg

(4S,5R) -4,5-Diphenyl-2- (quinolin-2-yl) -4,5-dihydrooxazole

Sign In for Pricing
View Details
(4S,5R) -4,5-Diphenyl-2- (quinolin-2-yl) -4,5-dihydrooxazole
OR1008272-02 1 g

(4S,5R) -4,5-Diphenyl-2- (quinolin-2-yl) -4,5-dihydrooxazole

Sign In for Pricing
View Details