Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAT1, Human (His)

TRAT1 protein stabilizes the T-cell antigen receptor (TCR) /CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TRAT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trat1-protein-human-his.html

Purity

95.0

Smiles

NISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN

Molecular Formula

50852 (Gene_ID) Q6PIZ9 (N29-N186) (Accession)

Molecular Weight

Approximately 30.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osbpl10 Mouse Gene Knockout Kit (CRISPR)
KN512639 1 Kit

Osbpl10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PELP1 Rabbit Monoclonal Antibody [Clone ID: 24GB1145]
TA425053S 20 µL

PELP1 Rabbit Monoclonal Antibody [Clone ID: 24GB1145]

Sign In for Pricing
View Details
KCNJ8 (N-term) Rabbit pAb
E2611888 100 µL

KCNJ8 (N-term) Rabbit pAb

Sign In for Pricing
View Details
Rat RL13 ELISA Kit
E105279 1 Each

Rat RL13 ELISA Kit

Sign In for Pricing
View Details
KSR2 Rabbit Polyclonal Antibody
AP20447PU-N 100 µg

KSR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bacillus cereus Pyrrolidone-carboxylate peptidase (pcp)
MBS1475739-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Pyrrolidone-carboxylate peptidase (pcp)

Sign In for Pricing
View Details