Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-12 beta, Human (His)

IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells) . Animal-Free IL-12 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-12 beta protein, expressed by E. coli , with His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-12 beta Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-12-beta-protein-human-his.html

Purity

95.0

Smiles

MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Molecular Formula

3593 (Gene_ID) P29460 (I23-S328) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesis Short Thread Cap; Blue; 9mm; Silicone/Red PTFE Septa; Slit
CHR1179 1000 / PCK

Kinesis Short Thread Cap; Blue; 9mm; Silicone/Red PTFE Septa; Slit

Sign In for Pricing
View Details
Phospho-BLNK (Tyr189) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-9688R-BF680 100 µL

Phospho-BLNK (Tyr189) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Mcam Rat shRNA Plasmid (Locus ID 78967)
TL710956 1 Kit

Mcam Rat shRNA Plasmid (Locus ID 78967)

Sign In for Pricing
View Details
CDRT5-set siRNA/shRNA/RNAi Lentivector (Human)
15760091 4x 500 ng

CDRT5-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
C10orf12 CRISPR Activation Plasmid (h2)
sc-408631-ACT-2 20 µg

C10orf12 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
UBASH3A (NM_018961) Human Tagged ORF Clone Lentiviral Particle
RC210190L4V 200 µL

UBASH3A (NM_018961) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details