Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROP-2, Human (187a.a, HEK293, Fc)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (187a.a, HEK293, Fc) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TROP-2 Protein, Human (187a.a, HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trop-2-protein-human-hek-293-fc.html

Purity

98.0

Smiles

TLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Molecular Formula

4070 (Gene_ID) P09758 (T88-T274) (Accession)

Molecular Weight

60-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM84B Polyclonal Antibody
E-AB-19849-01 20 µL

FAM84B Polyclonal Antibody

Sign In for Pricing
View Details
FAM84B Polyclonal Antibody
E-AB-19849-02 60 µL

FAM84B Polyclonal Antibody

Sign In for Pricing
View Details
FAM84B Polyclonal Antibody
E-AB-19849-03 120 µL

FAM84B Polyclonal Antibody

Sign In for Pricing
View Details
FAM84B Polyclonal Antibody
E-AB-19849-04 200 µL

FAM84B Polyclonal Antibody

Sign In for Pricing
View Details
EHM2 (EPB41L4B) (C-term) Rabbit Polyclonal Antibody
AP17339PU-N 400 µL

EHM2 (EPB41L4B) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
O4-Ethylthymine
TRC-E927020-50MG 50 mg

O4-Ethylthymine

Sign In for Pricing
View Details