Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL14/BRAK, Human

CXCL14 (also known as breast and kidney-expressed chemokine (BRAK) ), as a non-ELR CXC chemokine. CXCL14 displays chemotactic activity for monocytes but not for B and T cells. CXCL14 is involved in cancer, immune responses, and epithelial cell proliferation and migration. CXCL14 is a potent inhibitor of angiogenesis, and also shows antimicrobial activity[1][2]. CXCL14/BRAK Protein, Human is produced in E. coli, and consists of 77 amino acids (S35-E111) .

Product Specifications

Product Name Alternative

CXCL14/BRAK Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl14-brak-protein-human.html

Purity

98.0

Smiles

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Molecular Formula

9547 (Gene_ID) O95715 (S35-E111) (Accession)

Molecular Weight

Approximately 13-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Arezoo Gowhari Shabgah, et al. Chemokine CXCL14; a double-edged sword in cancer development. Int Immunopharmacol. 2021 Aug;97:107681.|[2]Joseph A Westrich, et al. The multifarious roles of the chemokine CXCL14 in cancer progression and immune responses. Mol Carcinog. 2020 Jul;59 (7) :794-806.|[3]Galina V Shurin, et al. Loss of new chemokine CXCL14 in tumor tissue is associated with low infiltration by dendritic cells (DC), while restoration of human CXCL14 expression in tumor cells causes attraction of DC both in vitro and in vivo. J Immunol. 2005 May 1;174 (9) :5490-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-100 1x 100 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-500 1x 500 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details