CXCL14/BRAK, Human
CXCL14 (also known as breast and kidney-expressed chemokine (BRAK) ), as a non-ELR CXC chemokine. CXCL14 displays chemotactic activity for monocytes but not for B and T cells. CXCL14 is involved in cancer, immune responses, and epithelial cell proliferation and migration. CXCL14 is a potent inhibitor of angiogenesis, and also shows antimicrobial activity[1][2]. CXCL14/BRAK Protein, Human is produced in E. coli, and consists of 77 amino acids (S35-E111) .
Product Specifications
Product Name Alternative
CXCL14/BRAK Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cxcl14-brak-protein-human.html
Purity
98.0
Smiles
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Molecular Formula
9547 (Gene_ID) O95715 (S35-E111) (Accession)
Molecular Weight
Approximately 13-15 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
HSF1, Sumoylation Site (Heat shock Factor Protein 1, HSF 1, Heat Shock Transcription Factor 1, HSTF 1, HSTF1) (MaxLight 490) discontinued
Rabbit Polyclonal Rabbit anti-Goat IgG Fc Secondary Antibody [DyLight 680]
Human Long Palate, Lung And Nasal Epithelium Carcinoma Associated Protein 4 ELISA kit