Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial

Product Specifications

Product Name Alternative

(Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)

Abbreviation

Recombinant Human Cd69 protein, partial

Gene Name

Cd69

UniProt

Q07108

Expression Region

64-199aa

Organism

Homo sapiens (Human)

Target Sequence

GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.0 kDa

References & Citations

"Soluble recombinant CD69 receptors optimized to have an exceptional physical and chemical stability display prolonged circulation and remain intact in the blood of mice." Vanek O., Nalezkova M., Kavan D., Borovickova I., Pompach P., Novak P., Kumar V., Vannucci L., Hudecek J., Hofbauerova K., Kopecky V. Jr., Brynda J., Kolenko P., Dohnalek J., Kaderavek P., Chmelik J., Gorcik L., Zidek L., Sklenar V., Bezouska K. FEBS J. 275:5589-5606 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBLIM1 Antibody
orb2312042-01 20 µg

FBLIM1 Antibody

Sign In for Pricing
View Details
FBLIM1 Antibody
orb2312042-02 100 µg

FBLIM1 Antibody

Sign In for Pricing
View Details
FBLIM1 Antibody
orb2312042-03 100 ug (without BSA and Azide)

FBLIM1 Antibody

Sign In for Pricing
View Details
Bcl10 (A-6) Alexa Fluor® 594
sc-13153 AF594 200 µg/mL

Bcl10 (A-6) Alexa Fluor® 594

Sign In for Pricing
View Details
Human Nkx3.1 protein
orb755887-01 50 µg

Human Nkx3.1 protein

Sign In for Pricing
View Details
Human Nkx3.1 protein
orb755887-02 100 µg

Human Nkx3.1 protein

Sign In for Pricing
View Details