Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plexin-B1 (PLXNB1), partial

Product Specifications

Product Name Alternative

(Semaphorin receptor SEP)

Abbreviation

Recombinant Human PLXNB1 protein, partial

Gene Name

PLXNB1

UniProt

O43157

Expression Region

35-150aa

Organism

Homo sapiens (Human)

Target Sequence

LQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

References & Citations

"Characterization and amino acid sequence of Neisseria gonorrhoeae dihydrofolate reductase." Baccanari D.P., Tansik R.L., Paterson S.J., Stone D. J. Biol. Chem. 259:12291-12298 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Platelet Derived Growth Factor BB (PDGF-BB) (MaxLight 405)
MBS6493783-01 0.1 mL

Platelet Derived Growth Factor BB (PDGF-BB) (MaxLight 405)

Sign In for Pricing
View Details
Platelet Derived Growth Factor BB (PDGF-BB) (MaxLight 405)
MBS6493783-02 5x 0.1 mL

Platelet Derived Growth Factor BB (PDGF-BB) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Protein grpE (grpE)
MBS1478957-01 0.02 mg (E-Coli)

Recombinant Burkholderia mallei Protein grpE (grpE)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Protein grpE (grpE)
MBS1478957-02 0.1 mg (E-Coli)

Recombinant Burkholderia mallei Protein grpE (grpE)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Protein grpE (grpE)
MBS1478957-03 0.02 mg (Yeast)

Recombinant Burkholderia mallei Protein grpE (grpE)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Protein grpE (grpE)
MBS1478957-04 0.1 mg (Yeast)

Recombinant Burkholderia mallei Protein grpE (grpE)

Sign In for Pricing
View Details