EPCR, Mouse (HEK293, His)
EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
EPCR Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/epcr-protein-mouse-hek293-his.html
Purity
96.00
Smiles
LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS
Molecular Formula
19124 (Gene_ID) Q64695 (L18-S214) (Accession)
Molecular Weight
Approximately 30-48 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880003-500 1x 500 µL
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040270-500 1x 500 µL
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550525-500 1x 500 µL
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details