Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPCR, Mouse (HEK293, His)

EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EPCR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epcr-protein-mouse-hek293-his.html

Purity

96.00

Smiles

LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS

Molecular Formula

19124 (Gene_ID) Q64695 (L18-S214) (Accession)

Molecular Weight

Approximately 30-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tweezers, 3C Dumont INOX, standard tip
07377-12 12 EA

Tweezers, 3C Dumont INOX, standard tip

Sign In for Pricing
View Details
Omeprazole Impurity 107
RM-O132407-01 10 mg

Omeprazole Impurity 107

Sign In for Pricing
View Details
Omeprazole Impurity 107
RM-O132407-02 25 mg

Omeprazole Impurity 107

Sign In for Pricing
View Details
Omeprazole Impurity 107
RM-O132407-03 50 mg

Omeprazole Impurity 107

Sign In for Pricing
View Details
Omeprazole Impurity 107
RM-O132407-04 100 mg

Omeprazole Impurity 107

Sign In for Pricing
View Details
1,2,3-Tri-10 (Z) -undecenoyl glycerol
T203053-01 10 mg

1,2,3-Tri-10 (Z) -undecenoyl glycerol

Sign In for Pricing
View Details