Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPO1/R-spondin-1, Human (125a.a, HEK293, His)

RSPO1 or R-spondin-1 activates the canonical Wnt pathway through ligand binding to the LGR4-6 receptor, forming a complex with phosphorylated LRP6 and Frizzled receptors. This interaction upregulates target gene expression. RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His) is the recombinant human-derived RSPO1/R-spondin-1 protein, expressed by HEK293 , with C-8*His labeled tag.

Product Specifications

Product Name Alternative

RSPO1/R-spondin-1 Protein, Human (125a.a, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rspo1-r-spondin-1-protein-human-125a-a-hek293-his.html

Purity

95.00

Smiles

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPA

Molecular Formula

284654 (Gene_ID) Q2MKA7-1 (S21-A146) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF640R conjugate, 0.1mg/mL
BNC402397-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details