Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GITR, Rat (HEK293, Fc)

GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Rat (HEK293, Fc) is a recombinant protein with a C-terminal Fc label, It consists of 121 amino acids (M1-K121) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

GITR Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gitr-protein-rat-hek293-fc.html

Purity

98.00

Smiles

EEPSCGPGRVRNGTGTNTRCCSLCGPDKEDCPKGRCICVKPEYHCEDPQCKTCKHYPCQPGQRVESQGNIKFGFQCVDCAMGTFSAGREGHCRLWTK

Molecular Formula

/ (Gene_ID) Q5M835 (E25-K121) (Accession)

Molecular Weight

Approximately 44 kDa

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-100 1x 100 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Transglutaminase II (TGM2/419), CF680R conjugate, 0.1mg/mL
BNC810419-100 1x 100 µL

Transglutaminase II (TGM2/419), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details