Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GITR, Rat (HEK293, Fc)

GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Rat (HEK293, Fc) is a recombinant protein with a C-terminal Fc label, It consists of 121 amino acids (M1-K121) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

GITR Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gitr-protein-rat-hek293-fc.html

Purity

98.00

Smiles

EEPSCGPGRVRNGTGTNTRCCSLCGPDKEDCPKGRCICVKPEYHCEDPQCKTCKHYPCQPGQRVESQGNIKFGFQCVDCAMGTFSAGREGHCRLWTK

Molecular Formula

/ (Gene_ID) Q5M835 (E25-K121) (Accession)

Molecular Weight

Approximately 44 kDa

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lipase maturation factor 1 (LMF1) ELISA Kit
RK13344 96 Tests

Mouse Lipase maturation factor 1 (LMF1) ELISA Kit

Sign In for Pricing
View Details
4-ethyl-1,5-dioxo-2,3,4,5-tetrahydropyrrolo[1,2-a]quinazoline-3a (1H) -carboxylic acid
sc-349450 250 mg

4-ethyl-1,5-dioxo-2,3,4,5-tetrahydropyrrolo[1,2-a]quinazoline-3a (1H) -carboxylic acid

Sign In for Pricing
View Details
rhoac Antibody
A48774-100UG 100 µg

rhoac Antibody

Sign In for Pricing
View Details
PCMV-SPORT6-STUB1
PPL00152 1 Each

PCMV-SPORT6-STUB1

Sign In for Pricing
View Details
ITFG2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1102807 1.0 µg DNA

ITFG2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
FAM164C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV811024 1.0 µg DNA

FAM164C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details