Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD200, Human (HEK293, His)

CD200 Protein stimulates T-cell proliferation and regulates myeloid cell activity in tissues. It interacts with CD200R1 through their Ig-like domains, indicating its role in immune response modulation and maintaining cellular homeostasis. CD200 Protein, Human (HEK293, His) is the recombinant human-derived CD200 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD200 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd200-protein-human-hek-293-his.html

Purity

98.0

Smiles

QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG

Molecular Formula

4345 (Gene_ID) P41217-1 (Q31-G232) (Accession)

Molecular Weight

35-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP3 Polyclonal Antibody, FITC Conjugated
A52907-100 100 µL

CASP3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
TP53I13 Protein Vector (Human) (pPM-C-HA)
PV043483 500 ng

TP53I13 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
FLJ12529 antibody
70R-1303 100 µL

FLJ12529 antibody

Sign In for Pricing
View Details
Nuclear RNA Export Factor 1 (NXF1) Antibody
abx457352-01 50 µg

Nuclear RNA Export Factor 1 (NXF1) Antibody

Sign In for Pricing
View Details
Nuclear RNA Export Factor 1 (NXF1) Antibody
abx457352-02 100 µg

Nuclear RNA Export Factor 1 (NXF1) Antibody

Sign In for Pricing
View Details
NLRP12 Ascites Mouse mAb
E2600205 100 µL

NLRP12 Ascites Mouse mAb

Sign In for Pricing
View Details