Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAG-3, Human (HEK293, Fc)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8 (+) and CD4 (+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (HEK293, Fc) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

LAG-3 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lag-3-protein-human-hek-293-fc.html

Purity

98.0

Smiles

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

Molecular Formula

3902 (Gene_ID) P18627-1 (L23-L450) (Accession)

Molecular Weight

70-90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)
MBS2058910-01 0.1 mL

PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)
MBS2058910-02 0.2 mL

PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)
MBS2058910-03 0.5 mL

PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)
MBS2058910-04 1 mL

PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)
MBS2058910-05 5 mL

PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)
MBS2058910-06 5x 5 mL

PE-Linked Polyclonal Antibody to Guanylate Binding Protein 4 (GBP4)

Sign In for Pricing
View Details