Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-alpha 2/IFNA2, Mouse (HEK293, Fc, solution)

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion[3]. IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, Fc) contains 167 a.a. (C24-E190), is produced in HEK293 cells with a N-terminal hFc-tag.

Product Specifications

Product Name Alternative

IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, Fc, solution), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-alpha-2-protein-mouse-hek293-fc.html

Purity

97.50

Smiles

CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Molecular Formula

15965 (Gene_ID) P01573 (C24-E190) (Accession)

Molecular Weight

Approximately 48-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Watanabe H, et al. Detailed structure of mouse interferon α2 and its interaction with Sortilin. J Biochem. 2021 Oct 11;170 (2) :265-273.|[2]Abraham S, et al. Gene therapy with plasmids encoding IFN-β or IFN-α14 confers long-term resistance to HIV-1 in humanized mice. Oncotarget. 2016 Nov 29;7 (48) :78412-78420.|[3]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[4]Sutter K, et al. Interferon α subtypes in HIV infection. Cytokine Growth Factor Rev. 2018 Apr;40:13-18.|[5]Gull I, et al. Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b. Springerplus. 2013 Jun 15;2 (1) :264.|[6]Paul F, et al. IFNA2: The prototypic human alpha interferon. Gene. 2015 Aug 10;567 (2) :132-7.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDHD1 siRNA Oligos set (Human)
50296171 3x 5 nmol

WDHD1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal TBC1D28 Antibody
NBP2-84291-0.1mL 0.1 mL

Rabbit Polyclonal TBC1D28 Antibody

Sign In for Pricing
View Details
OLR1 Knockout Hela Polyclonal Cells
ARG7844 1 Million

OLR1 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Anti-Human CD3 FITC
MBS696588-01 25 Tests

Anti-Human CD3 FITC

Sign In for Pricing
View Details
Anti-Human CD3 FITC
MBS696588-02 100 Tests

Anti-Human CD3 FITC

Sign In for Pricing
View Details
Anti-Human CD3 FITC
MBS696588-03 5x 100 Tests

Anti-Human CD3 FITC

Sign In for Pricing
View Details