Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lama glama Interleukin-4 (IL4)

Product Specifications

Product Name Alternative

(IL-4) (B-cell stimulatory factor 1) (BSF-1) (Lymphocyte stimulatory factor 1)

Abbreviation

Recombinant Lama glama IL4 protein

Gene Name

IL4

UniProt

Q865X5

Expression Region

25-133aa

Organism

Lama glama (Llama)

Target Sequence

HKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAPKNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLERLKKIMKEKYSKC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.4 kDa

References & Citations

"Cloning and sequence analysis of cytokine cDNAs of llama and camel." Odbileg R., Lee S.-I., Yoshida R., Chang K.-S., Ohashi K., Sugimoto C., Onuma M.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V (ANXA5) (NM_001154) Human Recombinant Protein
TP305619L 1 mg

Annexin V (ANXA5) (NM_001154) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805060 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
EIF4G2 Antibody
8C13062-AAT 50 µg

EIF4G2 Antibody

Sign In for Pricing
View Details
Recombinant ORAI3 Antibody
RC-5844-01 50 μL

Recombinant ORAI3 Antibody

Sign In for Pricing
View Details
Recombinant ORAI3 Antibody
RC-5844-02 100 µL

Recombinant ORAI3 Antibody

Sign In for Pricing
View Details
Recombinant ORAI3 Antibody
RC-5844-03 1 mL

Recombinant ORAI3 Antibody

Sign In for Pricing
View Details