Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Rat (HEK293, His)

TNFRSF3/LTBR Protein, Rat (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Rat (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (M222-W245) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-ltbr-protein-rat-hek293-his.html

Purity

96.00

Smiles

SQPQLVPPYRIENQTCWDPDKEYYEPLHQVCCSRCPPGKFVHAVCSPSQDTVCKTCLHNSYNEHWNHLFSCQLCRPCDSVLGFEEIAPCTSDRKPECRCKPGMSCVYLDNECVHCEEERLVLCRPGTEAEVTDEIMDTEVNCVPCKPGHFQNTSSPRARCQPHTRCESQGLVEAASGTSYSDTICKNPPEA

Molecular Formula

297604 (Gene_ID) Q5U2S8 (S28-A218) (Accession)

Molecular Weight

Approximately 30-37 kDa due to glycosylation

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX16 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
16670064 1.0 µg DNA

COX16 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CXCR1 CRISPR Knock Out 293T Cell Line (Human)
17180141 1x 10^6 Cells / 1.0 mL

CXCR1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Tropomyosin α (F-6) P
sc-376541 P 100 µg - 0.5 mL

Tropomyosin α (F-6) P

Sign In for Pricing
View Details
HSF1 (Phospho-S307) Rabbit Polyclonal Antibody
orb393320-01 30 µL

HSF1 (Phospho-S307) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSF1 (Phospho-S307) Rabbit Polyclonal Antibody
orb393320-02 50 μL

HSF1 (Phospho-S307) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSF1 (Phospho-S307) Rabbit Polyclonal Antibody
orb393320-03 100 µL

HSF1 (Phospho-S307) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details