Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free FGF-20, Human (His)

FGF-20 protein, a homodimer, functions as a neurotrophic factor essential for regulating central nervous system development and function.It interacts with specific receptors, FGFR2 and FGFR4, with heparan sulfate glycosaminoglycans enhancing the binding affinity between fibroblast growth factors (FGFs) and their receptors, serving as coreceptors in this intricate signaling process.Animal-Free FGF-20 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-20 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free FGF-20 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fgf-20-protein-human-his.html

Purity

98.0

Smiles

MPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Molecular Formula

26281 (Gene_ID) Q9NP95 (P3-T211) (Accession)

Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog