Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Alpha-actinin-4 (ACTN4), partial

Product Specifications

Product Name Alternative

Non-muscle alpha-actinin 4

Abbreviation

Recombinant Bovine ACTN4 protein, partial

Gene Name

ACTN4

UniProt

A5D7D1

Expression Region

1-269aa

Organism

Bos taurus (Bovine)

Target Sequence

MVDYHAANQSYQYGPSSGSNGAGGGGTMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. Probably involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation. Involved in tight junction assembly in epithelial cells probably through interaction with MICALL2. Links MICALL2 to the actin cytoskeleton and recruits it to the tight junctions. May also function as a transcriptional coactivator, stimulating transcription mediated by the nuclear hormone receptors PPARG and RARA.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glufosinate-ammonium
45520-01 100 mg

Glufosinate-ammonium

Sign In for Pricing
View Details
Rabbit Polyclonal Patched Domain Containing 2 Antibody [Alexa Fluor 532]
NBP2-81757AF532 0.1 mL

Rabbit Polyclonal Patched Domain Containing 2 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Phospho-C-RAF (Ser621) Colorimetric Cell-Based ELISA Kit
MBS9501153-01 1 Kit

Phospho-C-RAF (Ser621) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Phospho-C-RAF (Ser621) Colorimetric Cell-Based ELISA Kit
MBS9501153-02 5x 1 Kit

Phospho-C-RAF (Ser621) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Tspyl4 Mouse qPCR Template Standard (NM_030203)
MK203648 1 Kit

Tspyl4 Mouse qPCR Template Standard (NM_030203)

Sign In for Pricing
View Details
ARPM1 ORF Vector (Human) (pORF)
ORF000650 1.0 µg DNA

ARPM1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details