Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX4, Human (His)

PRDX4, a thiol-specific peroxidase, enzymatically reduces hydrogen peroxide and organic hydroperoxides, crucial for cellular protection. It detoxifies peroxides, acts as a sensor for hydrogen peroxide-mediated signaling, and contributes to NF-kappa-B activation regulation. PRDX4's multifaceted activity underscores its significance in cellular redox homeostasis and potential impact on intracellular signaling. PRDX4 Protein, Human (His) is the recombinant human-derived PRDX4 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx4-protein-human-his.html

Purity

97.00

Smiles

WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Molecular Formula

10549 (Gene_ID) Q13162 (W38-N271) (Accession)

Molecular Weight

27-30 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYOD1 pSer200 Rabbit Polyclonal Antibody
AP02375PU-S 50 µL

MYOD1 pSer200 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lipoprotein lipase (LPL) (NM_000237) Human Over-expression Lysate
LC400089 20 µg

Lipoprotein lipase (LPL) (NM_000237) Human Over-expression Lysate

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF740 conjugate, 0.1mg/mL
BNC740828-100 1x 100 µL

CD79a (JCB117 + HM47/A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TMEM51-AS2 activation kit by CRISPRa
GA118884 1 Kit

Human TMEM51-AS2 activation kit by CRISPRa

Sign In for Pricing
View Details
(2S,4R)-Sacubitril
TRC-S080905-25MG 25 mg

(2S,4R)-Sacubitril

Sign In for Pricing
View Details
SIAH1 Recombinant Rabbit monoclonal Antibody
HA750754 100 µL

SIAH1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details