Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX4, Human (His)

PRDX4, a thiol-specific peroxidase, enzymatically reduces hydrogen peroxide and organic hydroperoxides, crucial for cellular protection. It detoxifies peroxides, acts as a sensor for hydrogen peroxide-mediated signaling, and contributes to NF-kappa-B activation regulation. PRDX4's multifaceted activity underscores its significance in cellular redox homeostasis and potential impact on intracellular signaling. PRDX4 Protein, Human (His) is the recombinant human-derived PRDX4 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRDX4 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prdx4-protein-human-his.html

Purity

97.00

Smiles

WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

Molecular Formula

10549 (Gene_ID) Q13162 (W38-N271) (Accession)

Molecular Weight

27-30 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXI1 (Center) Rabbit Polyclonal Antibody
AP51709PU-N 400 µL

FOXI1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560696 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB550622 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
PAK4 Mouse Monoclonal Antibody [Clone ID: OTI1C11]
CF807298 100 µg

PAK4 Mouse Monoclonal Antibody [Clone ID: OTI1C11]

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF594 conjugate, 0.1mg/mL
BNC942923-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2923), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF640R conjugate, 0.1mg/mL
BNC402946-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details