Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2V1, Human (His)

The UBE2V1 protein does not have intrinsic ubiquitin ligase activity and can cooperate with UBE2N to synthesize non-canonical polyubiquitin chains linked through Lys-63. This type of polyubiquitination activates IKK and mediates NF-kappa-B activation, thereby affecting transcriptional activation, cell cycle progression, and DNA repair. UBE2V1 Protein, Human (His) is the recombinant human-derived UBE2V1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2V1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2v1-protein-human-his.html

Smiles

AATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQCYSN

Molecular Formula

7335 (Gene_ID) Q13404 (A2-N147) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF568 conjugate, 0.1mg/mL
BNC682348-100 1x 100 µL

Neurofilament (NF-H) (Neuronal Marker) (rNF421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), Biotin conjugate, 0.1mg/mL
BNCB0784-100 1x 100 µL

CD56 / NCAM (NCAM1/784), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCDC80 Antibody
KC-7648-01 50 μL

CCDC80 Antibody

Sign In for Pricing
View Details
CCDC80 Antibody
KC-7648-02 100 µL

CCDC80 Antibody

Sign In for Pricing
View Details
CCDC80 Antibody
KC-7648-03 1 mL

CCDC80 Antibody

Sign In for Pricing
View Details
STATIP1 (ELP2) Human Gene Knockout Kit (CRISPR)
KN417279 1 Kit

STATIP1 (ELP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details