PF4V1, Human (HEK293, Fc)
PF4V1, also known as CXCL4L1, is a non-allelic variant of CXCL4. PF4V1 is a platelet-associated chemokine, and it binds to heparin is much weaker than in the close homolog PF4/CXCL4. PF4V1 is an inhibitor of angiogenesis and inhibitor of endothelial cell chemotaxis. PF4V1 is involved in inflammation, angiogenesis, and cancer[1][2]. PF4V1 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 104 amino acids (M1-S104) .
Product Specifications
Product Name Alternative
PF4V1 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pf4v1-protein-human-hek293-fc.html
Purity
97.35
Smiles
FARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Molecular Formula
5197 (Gene_ID) NP_002611.1 (F31-S104) (Accession)
Molecular Weight
Approximately 38.7 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
Insulin (E2-E3), CF640R conjugate, 0.1mg/mL
