Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF4V1, Human (HEK293, Fc)

Selected Variant

HY-P76539-01

Size: 5 µg

PF4V1, also known as CXCL4L1, is a non-allelic variant of CXCL4. PF4V1 is a platelet-associated chemokine, and it binds to heparin is much weaker than in the close homolog PF4/CXCL4. PF4V1 is an inhibitor of angiogenesis and inhibitor of endothelial cell chemotaxis. PF4V1 is involved in inflammation, angiogenesis, and cancer[1][2]. PF4V1 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 104 amino acids (M1-S104) .

Product Specifications

Product Name Alternative

PF4V1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pf4v1-protein-human-hek293-fc.html

Purity

97.35

Smiles

FARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES

Molecular Formula

5197 (Gene_ID) NP_002611.1 (F31-S104) (Accession)

Molecular Weight

Approximately 38.7 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Pieter Ruytinx, et al. CXCL4 and CXCL4L1 in cancer. Cytokine. 2018 Sep;109:65-71.|[2]Dongyang Li, et al. PF4V1, an miRNA-875-3p target, suppresses cell proliferation, migration, and invasion in prostate cancer and serves as a potential prognostic biomarker. Cancer Manag Res. 2019 Mar 21;11:2299-2312.|[3]Jo Vandercappellen, et al. The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer. Cytokine Growth Factor Rev. 2011 Feb;22 (1) :1-18.|[4]Pieter Ruytinx, et al. Relative distribution and biological characterization of CXCL4L1 isoforms in platelets from healthy donors. Biochem Pharmacol. 2017 Dec 1;145:123-131.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Price

Sign In for Pricing

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CHGA/777), Biotin conjugate, 0.1mg/mL
BNCB0777-500 1x 500 µL

Chromogranin A (CHGA/777), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF488A conjugate, 0.1mg/mL
BNC881295-500 1x 500 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), CF488A conjugate, 0.1mg/mL
BNC881082-100 1x 100 µL

MHC II (HLA-DRA) (19-26.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HPV-18 (Human Papilloma Virus 18) (HPV18/1297), CF640R conjugate, 0.1mg/mL
BNC401297-100 1x 100 µL

HPV-18 (Human Papilloma Virus 18) (HPV18/1297), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF568 conjugate, 0.1mg/mL
BNC682939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP/872), CF640R conjugate, 0.1mg/mL
BNC400872-100 1x 100 µL

Retinol Binding Protein-1 (RBP/872), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details