Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF4V1, Human (HEK293, Fc)

PF4V1, also known as CXCL4L1, is a non-allelic variant of CXCL4. PF4V1 is a platelet-associated chemokine, and it binds to heparin is much weaker than in the close homolog PF4/CXCL4. PF4V1 is an inhibitor of angiogenesis and inhibitor of endothelial cell chemotaxis. PF4V1 is involved in inflammation, angiogenesis, and cancer[1][2]. PF4V1 Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 104 amino acids (M1-S104) .

Product Specifications

Product Name Alternative

PF4V1 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pf4v1-protein-human-hek293-fc.html

Purity

97.35

Smiles

FARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES

Molecular Formula

5197 (Gene_ID) NP_002611.1 (F31-S104) (Accession)

Molecular Weight

Approximately 38.7 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Pieter Ruytinx, et al. CXCL4 and CXCL4L1 in cancer. Cytokine. 2018 Sep;109:65-71.|[2]Dongyang Li, et al. PF4V1, an miRNA-875-3p target, suppresses cell proliferation, migration, and invasion in prostate cancer and serves as a potential prognostic biomarker. Cancer Manag Res. 2019 Mar 21;11:2299-2312.|[3]Jo Vandercappellen, et al. The role of the CXC chemokines platelet factor-4 (CXCL4/PF-4) and its variant (CXCL4L1/PF-4var) in inflammation, angiogenesis and cancer. Cytokine Growth Factor Rev. 2011 Feb;22 (1) :1-18.|[4]Pieter Ruytinx, et al. Relative distribution and biological characterization of CXCL4L1 isoforms in platelets from healthy donors. Biochem Pharmacol. 2017 Dec 1;145:123-131.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH2 Antibody
orb2672243-01 50 µL

SSH2 Antibody

Sign In for Pricing
View Details
SSH2 Antibody
orb2672243-02 100 µL

SSH2 Antibody

Sign In for Pricing
View Details
SSH2 Antibody
orb2672243-03 200 µL

SSH2 Antibody

Sign In for Pricing
View Details
SPBC1289.14 Antibody
orb853408 2 mg

SPBC1289.14 Antibody

Sign In for Pricing
View Details
Lekr1 HDR Plasmid (m)
sc-436942-HDR 20 µg

Lekr1 HDR Plasmid (m)

Sign In for Pricing
View Details
FGF19 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62245R-APC-Cy5.5 100 µL

FGF19 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details