Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

40S Ribosomal S3/RPS3, Human (His)

40S ribosomal protein S3 (RPS3) is an important component of the small ribosomal subunit and is integral to cellular protein synthesis. In addition to its ribosomal function, RPS3 exhibits endonuclease activity and plays a role in DNA repair. 40S Ribosomal Protein S3/RPS3 Protein, Human (His) is the recombinant human-derived 40S Ribosomal protein S3/RPS3 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

40S Ribosomal Protein S3/RPS3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/40s-ribosomal-protein-s3-rps3-human-his.html

Purity

92.00

Smiles

AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA

Molecular Formula

6188 (Gene_ID) P23396-1 (A2-A243) (Accession)

Molecular Weight

Approximately 32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-MGST2 Antibody
DL90739A-01 50 µL

Rabbit anti-MGST2 Antibody

Sign In for Pricing
View Details
Rabbit anti-MGST2 Antibody
DL90739A-02 100 µL

Rabbit anti-MGST2 Antibody

Sign In for Pricing
View Details
EGFR Biosimilar Antibody
orb3183016-01 100 µg

EGFR Biosimilar Antibody

Sign In for Pricing
View Details
EGFR Biosimilar Antibody
orb3183016-02 500 µg

EGFR Biosimilar Antibody

Sign In for Pricing
View Details
EGFR Biosimilar Antibody
orb3183016-03 1 mg

EGFR Biosimilar Antibody

Sign In for Pricing
View Details
EGFR Biosimilar Antibody
orb3183016-04 5 mg

EGFR Biosimilar Antibody

Sign In for Pricing
View Details