Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Podoplanin, Rat (HEK293, hFc)

The Podoplanin protein coordinates migration and adhesion by interacting with partners such as CLEC1B and CD9. It aids in blood vessel separation, platelet activation and platelet aggregation. Podoplanin Protein, Rat (HEK293, hFc) is the recombinant rat-derived Podoplanin protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Podoplanin Protein, Rat (HEK293, hFc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/podoplanin-protein-rat-hek293-hfc.html

Purity

98.0

Smiles

GAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTL

Molecular Formula

54320 (Gene_ID) Q64294 (G23-L135) (Accession)

Molecular Weight

Approximately 55-70 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human KITLG pAb
PA14249-01 50 μL

Rabbit Anti-Human KITLG pAb

Sign In for Pricing
View Details
Rabbit Anti-Human KITLG pAb
PA14249-02 100 μL

Rabbit Anti-Human KITLG pAb

Sign In for Pricing
View Details
Skint10 Lentiviral Activation Particles (m2)
sc-432958-LAC-2 200 µL

Skint10 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
C2ORF76 Adenovirus (Human)
14434051 1.0 mL

C2ORF76 Adenovirus (Human)

Sign In for Pricing
View Details
Ozagrel Impurity 38
RM-O260764-01 10 mg

Ozagrel Impurity 38

Sign In for Pricing
View Details
Ozagrel Impurity 38
RM-O260764-02 25 mg

Ozagrel Impurity 38

Sign In for Pricing
View Details