Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF145, Human (HEK293, solution)

VEGF145 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free. The total length of VEGF145 Protein, Human (HEK293) is 145 a.a., with molecular weight of ~16.92 kDa.

Product Specifications

Product Name Alternative

VEGF145 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf145-protein-human-hek293.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-6 (A27-R171) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNRC1 Human Gene Knockout Kit (CRISPR)
KN401936 1 Kit

PNRC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSPA4 Recombinant Rabbit Monoclonal Antibody [SD0861]
ET1612-83 100 µL

HSPA4 Recombinant Rabbit Monoclonal Antibody [SD0861]

Sign In for Pricing
View Details
STEAP4 Human Gene Knockout Kit (CRISPR)
KN416917 1 Kit

STEAP4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Relaxin 3 receptor 1 (RXFP3) (NM_016568) Human Over-expression Lysate
LC402566 20 µg

Relaxin 3 receptor 1 (RXFP3) (NM_016568) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD105 Antibody[MJ7/18]
E-AB-F1233M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD105 Antibody[MJ7/18]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD105 Antibody[MJ7/18]
E-AB-F1233M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD105 Antibody[MJ7/18]

Sign In for Pricing
View Details