Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF145, Human (HEK293, solution)

VEGF145 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free. The total length of VEGF145 Protein, Human (HEK293) is 145 a.a., with molecular weight of ~16.92 kDa.

Product Specifications

Product Name Alternative

VEGF145 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf145-protein-human-hek293.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-6 (A27-R171) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decabromodiphenylethane
TRC-D212800-10MG 10 mg

Decabromodiphenylethane

Sign In for Pricing
View Details
Meis homeobox 3 (MEIS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D9]
TA800265BM 100 µL

Meis homeobox 3 (MEIS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D9]

Sign In for Pricing
View Details
BRMS1 Antibody
8C11729-AAT 50 µg

BRMS1 Antibody

Sign In for Pricing
View Details
Human CPSF7 activation kit by CRISPRa
GA112691 1 Kit

Human CPSF7 activation kit by CRISPRa

Sign In for Pricing
View Details
IRS1 Mouse Monoclonal Antibody [Clone ID: OTI3G10]
CF808553 100 µg

IRS1 Mouse Monoclonal Antibody [Clone ID: OTI3G10]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700239 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details