Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF145, Human (HEK293, solution)

VEGF145 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free. The total length of VEGF145 Protein, Human (HEK293) is 145 a.a., with molecular weight of ~16.92 kDa.

Product Specifications

Product Name Alternative

VEGF145 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf145-protein-human-hek293.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-6 (A27-R171) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097P-01 50 Tests

PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097P-02 100 Tests

PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
1-Desoxycarbadox
TRC-D296999-50MG 50 mg

1-Desoxycarbadox

Sign In for Pricing
View Details
beta Synuclein (SNCB) Rabbit Polyclonal Antibody
TA372101 100 µL

beta Synuclein (SNCB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Total RNA Purification Kit - 96 Deep Well Plate Format-6p
24380 6 Plates

Total RNA Purification Kit - 96 Deep Well Plate Format-6p

Sign In for Pricing
View Details