Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF145, Human (HEK293, solution)

VEGF145 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free. The total length of VEGF145 Protein, Human (HEK293) is 145 a.a., with molecular weight of ~16.92 kDa.

Product Specifications

Product Name Alternative

VEGF145 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf145-protein-human-hek293.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-6 (A27-R171) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Brain
CS623332 5x 5 µm

Frozen Tissue Sections, Brain

Sign In for Pricing
View Details
Human AICAR (AICA Riboside) CLIA Kit
E-CL-H0946-01 24 Tests

Human AICAR (AICA Riboside) CLIA Kit

Sign In for Pricing
View Details
Human AICAR (AICA Riboside) CLIA Kit
E-CL-H0946-02 48 Tests

Human AICAR (AICA Riboside) CLIA Kit

Sign In for Pricing
View Details
Human AICAR (AICA Riboside) CLIA Kit
E-CL-H0946-03 96 Tests

Human AICAR (AICA Riboside) CLIA Kit

Sign In for Pricing
View Details
trans-Zeatin-d5
TRC-Z273065-25MG 25 mg

trans-Zeatin-d5

Sign In for Pricing
View Details
Mouse Sh3bgr activation kit by CRISPRa
GA205374 1 Kit

Mouse Sh3bgr activation kit by CRISPRa

Sign In for Pricing
View Details