Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF145, Human (HEK293, solution)

VEGF145 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free. The total length of VEGF145 Protein, Human (HEK293) is 145 a.a., with molecular weight of ~16.92 kDa.

Product Specifications

Product Name Alternative

VEGF145 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf145-protein-human-hek293.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-6 (A27-R171) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC27A6 activation kit by CRISPRa
GA109174 1 Kit

Human SLC27A6 activation kit by CRISPRa

Sign In for Pricing
View Details
Caspase-7 (CASP7) Mouse Monoclonal Antibody [Clone ID: MCH3-5]
AM05296PU-N 100 µg

Caspase-7 (CASP7) Mouse Monoclonal Antibody [Clone ID: MCH3-5]

Sign In for Pricing
View Details
CD99 / MIC2 (Ewing's Sarcoma Marker), CF594 conjugate, 0.1mg/mL
BNC941646-100 1x 100 µL

CD99 / MIC2 (Ewing's Sarcoma Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ARF1 (NM_001658) Human Over-expression Lysate
LY419819 100 µg

ARF1 (NM_001658) Human Over-expression Lysate

Sign In for Pricing
View Details
Mannose Phosphate Isomerase (MPI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C7]
TA504749AM 100 µL

Mannose Phosphate Isomerase (MPI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C7]

Sign In for Pricing
View Details
HSD17B13 (NM_178135) Human Recombinant Protein
TP313132-B 20 µg

HSD17B13 (NM_178135) Human Recombinant Protein

Sign In for Pricing
View Details