Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF145, Human (HEK293, solution)

VEGF145 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF145 Protein, Human (HEK293) is the recombinant human-derived VEGF145 protein, expressed by HEK293 , with tag free. The total length of VEGF145 Protein, Human (HEK293) is 145 a.a., with molecular weight of ~16.92 kDa.

Product Specifications

Product Name Alternative

VEGF145 Protein, Human (HEK293, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf145-protein-human-hek293.html

Purity

98.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-6 (A27-R171) (Accession)

Molecular Weight

Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse heparan sulfate,HS ELISA KIT
JOT-EKA0099Mo 96 wells

Mouse heparan sulfate,HS ELISA KIT

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O81 (strain ED1a) AIS Polyclonal Antibody
MBS7174866 Inquire

Rabbit anti-Escherichia coli O81 (strain ED1a) AIS Polyclonal Antibody

Sign In for Pricing
View Details
alpha 1 Antitrypsin (SERPINA1) (NM_001127705) Human Recombinant Protein
TP325661M 100 µg

alpha 1 Antitrypsin (SERPINA1) (NM_001127705) Human Recombinant Protein

Sign In for Pricing
View Details
Prominin 2 (PROM2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E5]
TA500310AM 100 µL

Prominin 2 (PROM2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E5]

Sign In for Pricing
View Details
RecombinantPDGF-BB, Mouse
orb1494778-01 1 mg

RecombinantPDGF-BB, Mouse

Sign In for Pricing
View Details
RecombinantPDGF-BB, Mouse
orb1494778-02 10 µg

RecombinantPDGF-BB, Mouse

Sign In for Pricing
View Details